DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT4G33720

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:175 Identity:41/175 - (23%)
Similarity:67/175 - (38%) Gaps:47/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKIILFLIAIEVCNQTIGIGLRSL-----ILEAHNRRRAKYGNQPMVLDEELCTECSEYADE--- 59
            :.|..||:.|        :.|::.     .|..|||.||:.|..|:..||::......||::   
plant    12 LAITFFLVLI--------VHLKAQDSPQDFLAVHNRARAEVGVGPLRWDEKVAAYARNYANQRKG 68

  Fly    60 ---IVRNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIW----FHYRGFAENTKYY 117
               :..:.|.|.||......:...::|                 |.:|    |.| .:..||..:
plant    69 DCAMKHSSGSYGENIAWSSGSMTGVAA-----------------VDMWVDEQFDY-DYDSNTCAW 115

  Fly   118 -----RFTAMIWNASTRLGVGLGRIQETR-YLVVRYAPPGNILRE 156
                 .:|.::|..|.|||....|....: ::...|.||||.:.|
plant   116 DKQCGHYTQVVWRNSERLGCAKVRCNNGQTFITCNYDPPGNWVGE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 34/141 (24%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.