DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT4G07820

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:117 Identity:26/117 - (22%)
Similarity:44/117 - (37%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AHNRRRAKYGNQPMVLDEELCTECSEYADE-----IVRNEGVYTE----------------NYL- 72
            ||||.|...|..|::..:.|......||::     :..:.|.|.|                .:| 
plant    35 AHNRARVSVGVSPLMWSQTLTAYAQAYAEKRRDCGLFLSGGPYGETIKADIIDFSAEEFVSTFLN 99

  Fly    73 ---EYLYATDPISA-----KHLQVVCVFREALPRECVRIWFHYRGFAENTKY 116
               :|.|.|:...|     .:.||  :||:::...|.::..:..||.....|
plant   100 QKSDYDYTTNTCRAGKSCDGYKQV--LFRKSVFLGCAKVKCNNGGFLAICSY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 26/117 (22%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.