DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT3G19690

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:170 Identity:41/170 - (24%)
Similarity:73/170 - (42%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILFLIAIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADE------IVRNE 64
            ||||:||.:...::...|:...|||||..|.:.|..|:|.|:|:....:.||::      :|.:.
plant     8 ILFLLAIALFYGSLAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSN 72

  Fly    65 GVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFH---YRGFAENT-------KYYRF 119
            |.:.||   ...::..:||:              :...:|.:   |..:..||       ....:
plant    73 GPFGEN---IAMSSGEMSAE--------------DAAEMWINEKQYYDYDSNTCNDPNGGTCLHY 120

  Fly   120 TAMIWNASTRLGVGLGRI---QETRYLVVRYAPPGNILRE 156
            |.::|..:.||  |..::   ....::...|.||||.:.|
plant   121 TQVVWKNTVRL--GCAKVVCNSGGTFITCNYDPPGNYIGE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 32/144 (22%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.