DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT3G09590

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:191 Identity:42/191 - (21%)
Similarity:65/191 - (34%) Gaps:61/191 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIKIILFLI------------------AIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEE 48
            |..::|||:                  |..:.|:.....|....|:|||..|...|...:..|.:
plant    10 SCLLLLFLLFSGHPSVLGTSIPDAVNTAARLVNRARRAKLSREFLQAHNDARVSSGVPTLGWDRD 74

  Fly    49 LCTECSEYADE------IVRNEGVYTENYLEYLYATDPISAKHLQVVCVF-----REALPRECVR 102
            |.....::|.:      ::.:.|.|.||                    :|     :...|.:.|.
plant    75 LARFADKWAKQRKSDCSMIHSGGPYGEN--------------------IFWHRRKKTWSPEKVVT 119

  Fly   103 IWFHYRGFAENTKYY---------RFTAMIWNASTRLGVGLGRIQETR-YLVV-RYAPPGN 152
            .||..| |..:.|..         .:|.|:|..:|.:|....:....| |||| .|.|.||
plant   120 RWFEER-FNYDVKTNTCAPGKMCGHYTQMVWRETTAVGCARVKCHNGRGYLVVCEYDPRGN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 35/148 (24%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.