DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT2G19980

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:172 Identity:46/172 - (26%)
Similarity:66/172 - (38%) Gaps:53/172 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILFLIAIEVCNQTIGIGLRSL----------ILEAHNRRRAKYGNQPMVLDEELCTECSEYADE 59
            |:|.|::| |..|.  .||||.          .|..||:.||        .|::|......||: 
plant     9 IVLTLLSI-VLTQI--YGLRSFSRMDDLQPAETLAVHNQIRA--------ADQKLAAHAQRYAN- 61

  Fly    60 IVRN---------EGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWF---HYRGFAE 112
             ||:         :|.|.||          |:|..:|.:......:   ..:.||   .|..:|.
plant    62 -VRSQDCAMKYSTDGTYGEN----------IAAGWVQPMDTMSGPI---ATKFWFTEKPYYNYAT 112

  Fly   113 N---TKYYRFTAMIWNASTRLGVGLGRIQETRY--LVVRYAP 149
            |   .....:|.::.|.||.||.|..|..:..|  :|..|||
plant   113 NKCSEPCGHYTQIVANQSTHLGCGTVRCFKNEYVWVVCNYAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/140 (26%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.