DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT2G19970

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:140 Identity:33/140 - (23%)
Similarity:54/140 - (38%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVR-----------NEGVYTENYLE-YLYATD- 79
            |:.||:.||..|..|:..::.:.....::|:...:           ::|.|.||... ::...| 
plant    39 LKVHNQIRAAVGVAPLKWNKTVAAYAQKFANRQAKAGVCDYSSMRHSDGPYGENIAAGWVQPKDQ 103

  Fly    80 ---PISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQETR 141
               ||:||:........:....:|..:..||            |.|:.|.|..||.|..|..|..
plant   104 MSGPIAAKYWLTEKPNYDHATNKCKDVCGHY------------TQMVANQSLSLGCGSFRCHENE 156

  Fly   142 --YLVVRYAP 149
              |:|..|.|
plant   157 LIYIVCNYYP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 33/140 (24%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.