DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Crispld2

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:197 Identity:35/197 - (17%)
Similarity:55/197 - (27%) Gaps:79/197 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIV---------------------- 61
            |..||..||:.|.:.     ..:.|..||||....:.:|...:                      
Mouse    56 RQEILMLHNKLRGQVYPPASNMEHMTWDEELERSAAAWAHRCLWEHGPAGLLRSIGQNLAVHWGR 120

  Fly    62 -RNEGVYTENYL----EYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTA 121
             |:.|.:.:::.    :|.|                  ..|.||..   ..|..........:|.
Mouse   121 YRSPGFHVQSWYDEVKDYTY------------------PYPHECTP---RCRERCSGPMCTHYTQ 164

  Fly   122 MIWNASTRLGVGLGRIQETR----------YLVVRYAPPGNILREMASNVPKRPTTFWDAEHIVD 176
            |:|..:.::|..:...:...          |||..|:|.||                |..|....
Mouse   165 MVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGN----------------WIGEAPYK 213

  Fly   177 HG 178
            ||
Mouse   214 HG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 29/167 (17%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 27/165 (16%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.