DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Pi16

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:168 Identity:40/168 - (23%)
Similarity:62/168 - (36%) Gaps:67/168 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHNRRRAKYGNQP------MVLDEELCTECSEYADEIV----RNEGVYTENYLEYLYA- 77
            :..:::.||:.||:. :.|      |..|:||......||.:.|    :..|...||    |:| 
Mouse    35 KQTMVDLHNQYRAQV-SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGEN----LFAI 94

  Fly    78 TD-----PISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRF--------------TAMI 123
            ||     |::                  |..|.      |..:||.|              |.::
Mouse    95 TDEGMDVPLA------------------VGNWH------EEHEYYNFSTATCDPNQMCGHYTQVV 135

  Fly   124 WNASTRLGVG------LGRIQET--RYLVVRYAPPGNI 153
            |:.:.|:|.|      |..::|.  ..||..|.||||:
Mouse   136 WSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 39/163 (24%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 35/161 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.