DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:138 Identity:23/138 - (16%)
Similarity:43/138 - (31%) Gaps:50/138 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPR 98
            |..|..:.|.:.....|.|..::..|.:         ||..:                  |..|.
Mouse    81 RECKLAHNPCIKQRYECLEDYDFIGENI---------YLGRI------------------ETQPE 118

  Fly    99 ECVRIWFHYRGFAENTKYYRF------------TAMIWNASTRLGVGLGRIQETR-----YLVVR 146
            :.|..|::      .:||:.|            |.::|..:.::|..:......:     ..|..
Mouse   119 DVVINWYN------ESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCN 177

  Fly   147 YAPPGNIL 154
            |:|.||.:
Mouse   178 YSPAGNFI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 22/135 (16%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 20/132 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841215
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.