DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Crisp1

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:200 Identity:44/200 - (22%)
Similarity:78/200 - (39%) Gaps:63/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIKIILFLIAIEVCNQTIG-IGLRSLILEAHNRRRAKYGNQPMVLDEELCTEC-SEYADEIV-- 61
            |::|:||.|.........:. :.||.|.|:     ||.|        .:|.||. :|..:|||  
  Rat     1 MAMKLILLLFLAATLTVFVPVVTLRHLKLD-----RALY--------NQLITESQTEPQEEIVDT 52

  Fly    62 -----RNEGVYTENYLEYLYATDPISAKHLQVVCVF-----REALPRE-----C----------- 100
                 ||......|.|:..:::  .:|::.:::..:     .::|.|.     |           
  Rat    53 HNAFRRNVSPPARNMLKMSWSS--AAAENARILARYCDKSDSDSLERRLPNTFCGENMHMENYPS 115

  Fly   101 -----VRIWFH---YRGFAE------NTKYYRFTAMIWNASTRLGVGLG---RIQETRYL-VVRY 147
                 :.||::   |..:.|      :.:.|.:|.|:|.:|..:|..:.   |.:...|| |..|
  Rat   116 SWSNVIEIWYNESKYFKYGEWPSTDDDIETYHYTQMVWASSYLIGCDVASCRRQKAATYLYVCHY 180

  Fly   148 APPGN 152
            ...||
  Rat   181 CHEGN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 35/172 (20%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 26/137 (19%)
Crisp 200..254 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344611
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.