DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and crispld2

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:171 Identity:37/171 - (21%)
Similarity:60/171 - (35%) Gaps:61/171 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIV-------------RNEGVYTENYLE 73
            |::.||:.|.:.     ..:.|..|:||......:|:|.:             :|..|:...|.:
 Frog    60 IIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEECIWEHGPTALLMSIGQNLAVHWGRYRQ 124

  Fly    74 YLYATDPISAKHLQ----VVCVFREALPREC---------VRIWFHYRGFAENTKYYRFTAMIWN 125
            ..|        |:|    .|..:....|.||         ..:..||            |.::|.
 Frog   125 PAY--------HVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHY------------TQIVWA 169

  Fly   126 ASTRLGVGL---------GRIQETR-YLVVRYAPPGNILRE 156
            .:|::|..:         |.|.|.. |||..|:|.||.:.|
 Frog   170 TTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 35/166 (21%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 32/161 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.