DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and pi15b

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:167 Identity:40/167 - (23%)
Similarity:60/167 - (35%) Gaps:53/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIV-------------RNEGVYTENYLE 73
            ||:.||:.||..     ..:.|:.|:.|......:|...:             :|..|.|.||..
Zfish    69 ILDYHNKVRANVFPPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYLGQNLSVRTGNYRS 133

  Fly    74 YLYATDPISAKHLQVVCVFREALPREC-----VRIW----FHYRGFAENTKYYRFTAMIWNASTR 129
            .|....|    ....|..:....||:|     :|.:    .||            |.|:|.:|.|
Zfish   134 ILQLVKP----WYDEVRDYMFPYPRDCNPHCPMRCYGPMCTHY------------TQMVWASSNR 182

  Fly   130 LGVGL---------GRI-QETRYLVVRYAPPGNILRE 156
            :|..:         |.: :|..|||..|:|.||.:.|
Zfish   183 VGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 38/162 (23%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.