DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and PI15

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:169 Identity:41/169 - (24%)
Similarity:60/169 - (35%) Gaps:57/169 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIVRNEGVYTENY-LEYLYATDPISAKH 85
            ||:.||:.|.|.     ..:.||.||.|......:|...:.:.|   .:| |.:|       .::
Human    70 ILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHG---PSYLLRFL-------GQN 124

  Fly    86 LQV-VCVFREALPRECVRIWFHYRGFAENTKYYRF----------------------TAMIWNAS 127
            |.| ...:|..|  :.|:.|:      :..|.|.|                      |.|:|..|
Human   125 LSVRTGRYRSIL--QLVKPWY------DEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATS 181

  Fly   128 TRLGVGLGRIQETR----------YLVVRYAPPGNILRE 156
            .|:|..:...|...          |||..|||.||.:.|
Human   182 NRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 39/164 (24%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.