DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and glipr2l

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001005978.1 Gene:glipr2l / 449805 ZFINID:ZDB-GENE-041010-53 Length:154 Species:Danio rerio


Alignment Length:153 Identity:42/153 - (27%)
Similarity:67/153 - (43%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEAHNRRRAKYGNQPMVLDEELCTECSEYADEIV----------RNEGVYTEN--YLEYLYATDP 80
            |:.||..|.|:...|:.|..:||:|.|.||:.:.          .:.|...||  :..|......
Zfish    14 LKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGNCGENLAWASYDQTGKD 78

  Fly    81 ISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQE-TRYLV 144
            ::.:....|..:.           |:..||:..|.:  |||::|..|.:||||.....: :.::|
Zfish    79 VTDRWYNEVNQYN-----------FNQPGFSSGTGH--FTAVVWKGSKKLGVGKAVASDGSTFVV 130

  Fly   145 VRYAPPGNILRE--MASNV--PK 163
            .||.|.|||..:  ..:||  ||
Zfish   131 ARYFPAGNITNQGHFQANVLPPK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/137 (26%)
glipr2lNP_001005978.1 SCP_GAPR-1_like 9..139 CDD:240182 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.