DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and scpr-A

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:59/166 - (35%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLIAIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYAD-EIVRNEGVYTEN 70
            |.|:.::.|        .||..:..:..|..|..|...|.:....| :||.| ||::.|   .||
  Fly    99 LALLNVKTC--------ESLPDKCRSTERFAYAGQNNALFQYSGAE-TEYTDAEIIKEE---IEN 151

  Fly    71 YLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLG 135
            :........|      :::..|.|.||.:.|.               :||..:...:|.:|....
  Fly   152 WFAERSNASP------EILASFPEELPNKAVT---------------KFTIAVAEKNTHVGCAAV 195

  Fly   136 RIQETRY----LVVRYAPPGNILREMASNVPKRPTT 167
            |.....|    |...:| ..||:.:......::.||
  Fly   196 RFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 27/130 (21%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 31/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.