DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and scpr-B

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:166 Identity:35/166 - (21%)
Similarity:59/166 - (35%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLIAIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYAD-EIVRNEGVYTEN 70
            |.|:.::.|        .||..:..:..|..|..|...|.:....| :||.| ||::.:   .||
  Fly    97 LALLNVKTC--------ESLPDKCRSTERFAYAGQNNALFQYSGAE-TEYTDAEIIKEQ---IEN 149

  Fly    71 YLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLG 135
            :........|      :::..|.|.||.:.|.               :||..:...:|.:|....
  Fly   150 WFAERSNASP------EILASFPEELPNKAVT---------------KFTIAVAEKNTHVGCAAV 193

  Fly   136 RIQETRY----LVVRYAPPGNILREMASNVPKRPTT 167
            |.....|    |...:| ..||:.:......::.||
  Fly   194 RFSRDFYNHFVLTCNFA-TSNIVGQPVYTPGEKATT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 26/130 (20%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 30/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455176
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.