DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG11977

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:132 Identity:22/132 - (16%)
Similarity:52/132 - (39%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RRRAKY--GNQPMVL-------DEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQV 88
            ||:.::  ||.|..:       |:||.......:::.:::  .::.....:||.....|:..::|
  Fly    92 RRKLEWGLGNLPRAVKFKNIKWDDELSVMAMRVSNQCLQH--TFSPCVNTFLYKDVGESSDFVKV 154

  Fly    89 VCVFREALPRECVRIWFHYR------------GFAENTKYYRFTAMIWNASTRLGVGLGRIQETR 141
            ....:.......:.:||.|.            ..|...:...|..:|:..:.::|.|:.:..:.|
  Fly   155 QNTSKGFNVISFLNMWFEYHKMMKPSYVNNFPNIAPQDRLIIFANLIYEKNKKMGCGMVKSGQGR 219

  Fly   142 YL 143
            :|
  Fly   220 FL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 22/132 (17%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 22/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.