DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG31482

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:172 Identity:53/172 - (30%)
Similarity:82/172 - (47%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILFLIAIEVCNQTIGIG-LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGV-- 66
            ::..||.:.:|...:.|. |:...|..|||.|.|:|:.|:.||:||...|.|||..:..||.:  
  Fly     3 LVNILIVLALCLLVLVIADLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEH 67

  Fly    67 ---YTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIW--------FHYRGFAENTKYYRFT 120
               ..:||.|.|              |: |...|.:||:.|        |....||.:|.:  ||
  Fly    68 SSSAGQNYGENL--------------CM-RSQTPLQCVQDWYDEIADYDFEKPQFAMSTGH--FT 115

  Fly   121 AMIWNASTRLGVGLGRIQETRYLVV-RYAPPGNILREMASNV 161
            |::|..:.::|:|..:.::..|.|| ||.||.|:..:...||
  Fly   116 ALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 45/139 (32%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 46/144 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.