DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and crisp1.7

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_989314.1 Gene:crisp1.7 / 394939 XenbaseID:XB-GENE-5779195 Length:244 Species:Xenopus tropicalis


Alignment Length:187 Identity:35/187 - (18%)
Similarity:61/187 - (32%) Gaps:54/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHN--RRRAKYGNQPMV-----LDEE-----LCTECSEYADEIVRNEGVYTENYLEYLY 76
            |..|::.||  ||.|......|:     ::.|     ..|.|::|..:                 
 Frog    34 RQKIVDIHNAYRRSANPTASNMLKMSWSIEAENNAKNWATTCNQYHSQ----------------- 81

  Fly    77 ATDPISAKHLQVVC---VFREALPRECVRIWFHYRGFAENTKY-----------YRFTAMIWNAS 127
               |.:.:...:.|   :|..:.|.....:........:|.:|           ..:|.::|..|
 Frog    82 ---PAARQIANITCGENLFMSSYPASWEEVIQSLHSEYDNFEYGVGAKAVGLVIGHYTQVMWYKS 143

  Fly   128 TRLGVGLGR-----IQETRYLVVRYAPPGNILREMASNVP-KRPTTFWDAEHIVDHG 178
            .|:|.....     ::...|.|.:|.|.||....:  |.| |...:..|.....|:|
 Frog   144 YRIGCYCTECPNDGVRLKYYYVCQYYPAGNYADRI--NYPYKSGPSCADCPDACDNG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 27/156 (17%)
crisp1.7NP_989314.1 CAP_CRISP 32..171 CDD:349402 26/156 (17%)
Crisp 188..243 CDD:369954 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.