DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and crispld1b

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_009296842.1 Gene:crispld1b / 393442 ZFINID:ZDB-GENE-040426-1204 Length:509 Species:Danio rerio


Alignment Length:161 Identity:41/161 - (25%)
Similarity:59/161 - (36%) Gaps:47/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LILEAHNRRRAKY-----GNQPMVLDEELCTECSEYA-------------DEIVRNEGVYTENYL 72
            |||:.||:.|.:.     ..:.||.|.||......:|             ..|.:|.|.:     
Zfish    65 LILDLHNKLRGQVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTRIGQNLGAH----- 124

  Fly    73 EYLYATDPISAKHLQV----VCVFREALPRECVRIWFH--YRGFAENTKYYRFTAMIWNASTRLG 131
               :..|.....|:|.    |..|....|:||..   |  ||.......:|  |.::|..|.::|
Zfish   125 ---WGRDRPPTFHVQAWYDEVRDFSYPYPQECNP---HCPYRCSGPVCTHY--TQLVWATSNKIG 181

  Fly   132 VGL---------GRI-QETRYLVVRYAPPGN 152
            ..:         |.| .:..|||..|:||||
Zfish   182 CAINVCYNMNVWGMIWAKAVYLVCNYSPPGN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 40/160 (25%)
crispld1bXP_009296842.1 SCP_euk 64..208 CDD:240180 36/155 (23%)
LCCL 301..385 CDD:128866
LCCL 404..501 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585669
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.