DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG6628

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:187 Identity:34/187 - (18%)
Similarity:58/187 - (31%) Gaps:60/187 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLRSLILEAHNRRR-----AKYGNQP------------------------MVLDEELCTECSEYA 57
            ||:.|||..||..|     .|..|.|                        .||..:.|....::.
  Fly    67 GLQDLILGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFH 131

  Fly    58 DE----------IVRNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAE 112
            :.          ::..:|.:|:..|    ..:.|.....|.:.:.:|.|.|      |......:
  Fly   132 NSGQNLALVNITLLPEDGNHTDECL----VKESIGGWWNQSINITKEQLQR------FPKGKLGD 186

  Fly   113 NTKYYRFTAMIWNASTRLGVGLGRIQETRYLVVRYAPPGNILREMASNVPKRPTTFW 169
            :.:  .|..|..:.:|.:|....|.::         |.|:.|..:|.|........|
  Fly   187 SIR--NFAVMARDNNTHVGCAALRFEK---------PAGHPLFLLACNYASNYVPDW 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 27/164 (16%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 31/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.