DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG34002

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster


Alignment Length:177 Identity:36/177 - (20%)
Similarity:62/177 - (35%) Gaps:46/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRSLILEAHNRRR-------------------AKYGNQPMVLDEELCTECS-EYADEIVRNEGVY 67
            ::.|||..||..|                   .|:.::..:|...|...|. :..|..:..|...
  Fly    68 IKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFS 132

  Fly    68 TENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWF-HYRGFAENT----------KYYRFTA 121
            :.:| ..:|  :...||.    ..||  :.|..:..|: .|:..:.::          :...|..
  Fly   133 SPSY-HAVY--NKFKAKE----DTFR--IVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLR 188

  Fly   122 MIWNASTRLGVGLGRIQE----TRYLVVRY--APPGNILREMASNVP 162
            ||...|.|||..:..|::    .::|...|  :|..|.|....|..|
  Fly   189 MIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSLLYEYSGKP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 31/162 (19%)
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/158 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.