DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG3640

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611950.1 Gene:CG3640 / 37942 FlyBaseID:FBgn0035042 Length:296 Species:Drosophila melanogaster


Alignment Length:163 Identity:35/163 - (21%)
Similarity:61/163 - (37%) Gaps:56/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IAIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYAD-EIVRNE-----GVYT 68
            :|.:.|:.: |.|.|       |.||.|:..|   |...:.....:::| |::|::     |.|.
  Fly   108 LAAKRCSLS-GDGCR-------NTRRFKHVGQ---LTGHVIFSAGKHSDLELLRHKISNWFGQYM 161

  Fly    69 ENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVG 133
            ....: |.|.||.|.     :..||:                           :|..:||.:|.|
  Fly   162 RASKD-LQAADPSSN-----ISSFRQ---------------------------LIQESSTHMGCG 193

  Fly   134 LGR-----IQETRYLVVRYAPPGNILREMASNV 161
            :.|     :...:::|..:| ..|:.||....|
  Fly   194 VLRQRSHMLWHQQFIVCNFA-RRNMPREQVYQV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 26/136 (19%)
CG3640NP_611950.1 SCP_euk 65..213 CDD:240180 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455181
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.