DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG17974

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:108 Identity:27/108 - (25%)
Similarity:36/108 - (33%) Gaps:46/108 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEAHNRRR--AKYGNQP----------MVLDEEL-----------------CTECSEYADEIVRN 63
            |.|||:||  ...|..|          ||.|:||                 |.....||     |
  Fly    67 LHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYA-----N 126

  Fly    64 EGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFH 106
            .|       :.|.|.....:.|:.|.     :|..||:.:||:
  Fly   127 SG-------QNLCAVWRPRSPHVNVT-----SLVEECLGLWFN 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 27/108 (25%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 27/108 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.