DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG10651

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:101 Identity:25/101 - (24%)
Similarity:43/101 - (42%) Gaps:31/101 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SLILEAHNRRRAKYGNQPMVLDE----------ELCTECSEYAD------EIVRNEGVYTENY-- 71
            :||::.||..|.|:...   :|:          |...|.::.||      |.:|::...|.||  
  Fly    62 ALIVDKHNEYRNKFAGG---MDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123

  Fly    72 LEYLYATDPISAKHLQVVCVF--REALPRECVRIWF 105
            .|..|:.:       :..|:.  :||| |:.:..||
  Fly   124 AEVSYSLE-------KYFCMTTKKEAL-RKQLDHWF 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 24/99 (24%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.