DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG4270

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:172 Identity:41/172 - (23%)
Similarity:68/172 - (39%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLIAIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGV----- 66
            |||  .||.|.|             |:.||.:|...:.::..|.....|:|:.: |::..     
  Fly    30 LFL--KEVFNTT-------------NKYRAMHGCPAVTINAALNKLAQEWANHL-RDQNTMAHRP 78

  Fly    67 ---YTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWF-HYRGFAENTKYY-----RFTAM 122
               |.||.  :|.....::..           ||   |.:|: ....:..|...:     .||.:
  Fly    79 NPKYGENI--FLSGGMDVTGD-----------LP---VEMWYREINSYDFNKAQFVPTAGHFTQL 127

  Fly   123 IWNASTRLGVGLGRIQETRYLVVRYAPPGNILREMASNVPKR 164
            ||.:|..:|.|:.|..:..::|..|.||||::.....|||.:
  Fly   128 IWKSSVEMGSGVARKADRTWVVCNYNPPGNVVGLFKDNVPPK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 30/139 (22%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 36/158 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.