DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and glipr2

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:166 Identity:42/166 - (25%)
Similarity:69/166 - (41%) Gaps:30/166 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTEN--YLEYLYATDPIS 82
            |....:..|:.||..|.::|..|:..::.||....::|:.::..:.:...|  |.|.||.....:
Zfish     3 GTSFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGYGENLYYAWSSA 67

  Fly    83 AKHLQVVCVFREALPRECVRIW--------FHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQE 139
            .|.|         ...|.|..|        |...||:..|.:  ||.::|..:..|||||.....
Zfish    68 NKKL---------TGNEAVDSWYGEIKDYNFSRPGFSSKTGH--FTQVVWKDTKELGVGLATDGN 121

  Fly   140 TRYLVVRYAPPGNI---------LREMASNVPKRPT 166
            |.::|.:|.|.|||         :....|.:.::||
Zfish   122 TIFVVGQYLPAGNIANAGYFEKNVLPTGSKLDQKPT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 36/135 (27%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 36/140 (26%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.