DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG31286

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:172 Identity:59/172 - (34%)
Similarity:85/172 - (49%) Gaps:27/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILFLIAIE-------VCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVR 62
            :|:||:||.       :.:...||.||.:     |:||.::|...:.||..|...|..||.::.:
  Fly     8 VIVFLVAISEFDRNFAINHDNAGIVLREI-----NKRRDRHGVPKLTLDNVLSKGCQSYAWKLSK 67

  Fly    63 NEGVYTENYLEYLYATDPISAKHLQVVCVF---REALPRECVRIWFHYRGF-AENTKYYRFTAMI 123
            :.   |.||      :||.:..:.:.:|.|   |.||.| ||:.|::.|.| ..:.|...|||||
  Fly    68 SA---TLNY------SDPTNKDYTESICRFEVKRGALSR-CVKNWYNGRKFDILDPKAKDFTAMI 122

  Fly   124 WNASTRLGVGLGRIQETR-YLVVRYAPPGNILREMASNVPKR 164
            |.:|..||.|...|...: ..||||.||||:......|||.|
  Fly   123 WRSSVSLGYGDANINALQGVFVVRYTPPGNVKGLYTDNVPPR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 45/130 (35%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 49/140 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.