DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Glipr1

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:150 Identity:31/150 - (20%)
Similarity:53/150 - (35%) Gaps:45/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQVV------CVFREALPREC 100
            |.:.:|:...||.|..:.. |::.......:.|: :.||   |..|:.      |||:.. |:..
  Rat    26 PKITNEDFIEECVEVHNHF-RSKAYPPAGNMLYM-SWDP---KLAQIAKAWAQSCVFQHN-PQLH 84

  Fly   101 VRIWFHYRGFAEN---------------------TKYYRF------------TAMIWNASTRLGV 132
            .||..::.|..||                     ::||.|            |.::|..|.::|.
  Rat    85 SRIHPNFTGLGENIWLGSLSLFSVRAAILAWFEESQYYDFSTGKCKKVCGHYTQIVWADSYKIGC 149

  Fly   133 GLGRIQETRYLVVRYAPPGN 152
            .:.........:..|.|.||
  Rat   150 AVQLCPRGANFICNYGPAGN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 30/149 (20%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.