DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Pi16

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:168 Identity:40/168 - (23%)
Similarity:61/168 - (36%) Gaps:67/168 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHNRRRAKYGNQP------MVLDEELCTECSEYADEIV----RNEGVYTENYLEYLYA- 77
            :..::|.||..||:. :.|      |..|:||......||.:.|    :..|...||    |:| 
  Rat    39 KQTMVELHNHYRAQV-SPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGEN----LFAI 98

  Fly    78 TD-----PISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYY--------------RFTAMI 123
            ||     |::                  |..|.      |..:||              .:|.::
  Rat    99 TDEGMDVPLA------------------VGNWH------EEHEYYNLSTATCDPGQMCGHYTQVV 139

  Fly   124 WNASTRLGVG------LGRIQET--RYLVVRYAPPGNI 153
            |:.:.|:|.|      |..::|.  ..||..|.||||:
  Rat   140 WSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 39/163 (24%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.