DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and F09B9.5

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:192 Identity:36/192 - (18%)
Similarity:64/192 - (33%) Gaps:78/192 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRN-------------------EGVYTENY 71
            ::|| ||.||..:....:...|||.....::||::.:.                   ..:..|:.
 Worm    14 MLLE-HNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSGIGENITFFPPDIDAESV 77

  Fly    72 LEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGR 136
            :|:.|                     :|..:..:...|:...|.|  ||.:||.::..:|||...
 Worm    78 VEHWY---------------------QEHEKYEYETPGWQTGTNY--FTQVIWRSTKEIGVGCAY 119

  Fly   137 IQET---------------------------------RYLVVRYAPPGNILR--EMASNVPK 163
            ::::                                 :.:|..|.|.||..|  :.||||.|
 Worm   120 VRKSHENDEDNTSCSNGSVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVLK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 29/177 (16%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 28/177 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.