DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and antr

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:55/154 - (35%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NQTIGIGLRSLILEAHNRRRAKYGN-------QPMVLDEELCTECSEYADEIVR---NEGVYTEN 70
            |..:..|:.|.|....|...:..||       ..|..|.||    ...||..||   ..|.:..|
  Fly    59 NGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFEL----QRLADRQVRQCDETGKFCAN 119

  Fly    71 YLEYLY-ATDPISAKHLQVVCVFREALPRECVRIWFHYRG----------FAENTKYYRFTAMIW 124
            ..:|.| ||..|.:|..:...:....|.:....::....|          ..|.|....:..:|.
  Fly   120 TDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQ 184

  Fly   125 NASTRLGVGL---GRIQETRYLVV 145
            :..:|:|.||   ||.::...:::
  Fly   185 DHGSRMGCGLRVKGRDEKESNIIL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 31/143 (22%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.