DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and F57B7.2

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:161 Identity:45/161 - (27%)
Similarity:65/161 - (40%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQVVCVF 92
            |:|||..|.:|||:.:....||......:|.::.....|        ||...|...::|    :.
 Worm   159 LDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRV--------LYPELPGIGENL----IL 211

  Fly    93 REA-----LP--RECVRIWFHYRGFAE------NTKYYRFTAMIWNASTRLGVGLGRIQETRY-- 142
            :||     ||  :|.::.|.....|.:      |.|..||:.::|..:|.||.       .||  
 Worm   212 KEANEQSHLPTGQEVIQEWEKEAQFFDFDKPRWNPKCQRFSQVVWKDTTELGA-------ARYWN 269

  Fly   143 -------LVVRYAPPG--NILREMASNVPKR 164
                   :|..|.|.|  |...|.|||||.|
 Worm   270 TANNCVAVVCFYRPAGNSNAPGEFASNVPSR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 37/148 (25%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.