powered by:
Protein Alignment CG32313 and vap-1
DIOPT Version :9
Sequence 1: | NP_001261262.1 |
Gene: | CG32313 / 317973 |
FlyBaseID: | FBgn0052313 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001024553.1 |
Gene: | vap-1 / 181768 |
WormBaseID: | WBGene00006886 |
Length: | 424 |
Species: | Caenorhabditis elegans |
Alignment Length: | 39 |
Identity: | 11/39 - (28%) |
Similarity: | 19/39 - (48%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 FTAMIWNASTRLGVGLGRIQETRYLVVRYAPPGNILREM 157
:|.|.|..:|.:|..:.......|.|.:|.|.||.:.::
Worm 356 YTQMAWEGTTEIGCFVENCPTFTYSVCQYGPAGNYMNQL 394
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32313 | NP_001261262.1 |
SCP |
27..153 |
CDD:294090 |
10/33 (30%) |
vap-1 | NP_001024553.1 |
SCP |
31..175 |
CDD:214553 |
|
SCP |
234..386 |
CDD:214553 |
8/29 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.