DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and scl-5

DIOPT Version :10

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:65 Identity:21/65 - (32%)
Similarity:32/65 - (49%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 WSAGVLLYALLSGVLPFKGD-SLDAIFEAIKNVKLDFNTGVWESVSKPA-RDLLARMLTREESAR 343
            |  ||.|::|.:.:.|:..| ||.|:..|...|      ||.|.|:.|. .:::||.....|.:|
 Worm     3 W--GVALWSLATFLTPWAADSSLWALLAARAMV------GVAEGVALPCMNNMVARWFPPTERSR 59

  Fly   344  343
             Worm    60  59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 CAP_GAPR1-like 23..153 CDD:349401
scl-5NP_502506.1 SCP 22..175 CDD:214553 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.