DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and scl-5

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_502506.1 Gene:scl-5 / 178253 WormBaseID:WBGene00008027 Length:208 Species:Caenorhabditis elegans


Alignment Length:194 Identity:32/194 - (16%)
Similarity:53/194 - (27%) Gaps:77/194 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYLYATDPISAKHLQV 88
            ::.||..||..|::..                        :|.|.........|:|.:..|....
 Worm    24 QAAILNVHNTLRSRIA------------------------KGTYVAKGTAKPAASDMLKMKWDAT 64

  Fly    89 VCVFREALPRECVRIWFHYRGFAENTKYYRFTAMI----------------------WNAST--- 128
            |....:|...:|........|..||..:|..:|.|                      |:::|   
 Worm    65 VAASAQAYANKCPTGHSGAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSM 129

  Fly   129 -RLGVGLGRIQETRY------------------------LVVRYAPPGNILREMASNVPKRPTT 167
             ....|:|...:..:                        :|.:|.|.||.|.:   |:....||
 Worm   130 SLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQ---NIYTSGTT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 27/175 (15%)
scl-5NP_502506.1 SCP 22..175 CDD:214553 25/174 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161809
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.