DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and CG42764

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster


Alignment Length:206 Identity:55/206 - (26%)
Similarity:87/206 - (42%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILFLIAIEVCNQTIGIG-LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYA---------DE 59
            :.||.:|...|   :|.. :||...:|||..|..:....::..:||..:..|||         |:
  Fly     3 LFLFFLAFRPC---LGYNVIRSEAYDAHNDHRRTWVVPELIESDELSHDAEEYAIHLATLNIPDQ 64

  Fly    60 IV------RNEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWF-----------HY 107
            |:      ||..|   ::|:| ..::|.:..:.:.:|.|   :..|||..|.           ..
  Fly    65 ILYETAKDRNIRV---DHLDY-PLSEPENDFYTENICEF---IRNECVYYWASEGAASYGIAKER 122

  Fly   108 RGFAENTKYYRFTAMIWNASTRLGVGL---------GRIQETRYLVVRYAPPGNILREMASNVP- 162
            |...|.:...:|:|:.|.::|.:|||.         ||    :.|||||:|.||...|.|.|:. 
  Fly   123 RTKVEQSLADKFSAITWKSTTEMGVGWAPKDRSKKGGR----KILVVRYSPAGNQPGEYAENIGD 183

  Fly   163 -------KRPT 166
                   |.||
  Fly   184 TEFLEYFKMPT 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 41/160 (26%)
CG42764NP_001189140.1 SCP 22..172 CDD:294090 40/160 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.