DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and crisp1.11

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031758901.1 Gene:crisp1.11 / 100492430 XenbaseID:XB-GENE-22169829 Length:266 Species:Xenopus tropicalis


Alignment Length:192 Identity:37/192 - (19%)
Similarity:59/192 - (30%) Gaps:77/192 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIEVCNQTIGIGLRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVRNEGVYTENYLEYL 75
            :|...|.|:    |.:|::.||..|                          ||......|.|:.:
 Frog    51 SISTDNSTV----RQIIIDTHNAYR--------------------------RNASPSARNMLKMV 85

  Fly    76 YATDPI-SAKHLQVVC--------------------VFREALP---RECVRIWFHYRGFAENTKY 116
            :..|.. :|......|                    :|..:.|   .|.|:.||.     ||..:
 Frog    86 WNEDAANNAASWSAGCTGSHSPPDKRTIPGFSCGENLFLASYPASWEEAVKAWFD-----ENESF 145

  Fly   117 Y-------------RFTAMIWNASTRLGVGLGRIQETRY---LVVRYAPPGNILREMASNVP 162
            .             .:|.::|..|..:|..:....:::|   .|.:|.|.|||  |...|.|
 Frog   146 EYGVGPKSPDQVVGHYTQVMWYNSYMVGCSVSYCPKSQYKYFYVCQYCPAGNI--EGVMNTP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 28/165 (17%)
crisp1.11XP_031758901.1 CAP_CRISP 58..195 CDD:349402 28/171 (16%)
Crisp 212..263 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.