DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and LOC100490275

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:193 Identity:39/193 - (20%)
Similarity:64/193 - (33%) Gaps:70/193 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIAIEVCNQTIGIGLRSL--------------ILEAHNRRRAKYGNQP-----MVLDEELC---- 50
            ::.:.||      |.|.|              ::.|||..|.::|.|.     |..|..|.    
 Frog     7 MLVVSVC------GARQLDPTPAYNNERFVTDLVNAHNDIRNEFGKQAANMLHMSWDVGLAKLAQ 65

  Fly    51 ---TECSEYADEIVRNEGVYT--ENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGF 110
               ..|.:..:..:..|.:|.  :...|.||....|.        :|:      .|..|    |.
 Frog    66 AWTINCKKVPNPHLNKESIYPRFKQIGENLYMGPSID--------IFK------IVTNW----GL 112

  Fly   111 AENTKYY--------------RFTAMIWNASTRLGVGLGR-IQETRYLV-VRYAPPGNILREM 157
            ..|  :|              .||.::|..:.::|.|... ..:..|:| ..|.|.||:|.::
 Frog   113 EGN--FYDLKNNSCQPGKDCSHFTQIVWANTYKVGCGAAYCAHKVAYVVSCTYGPRGNLLGQV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 32/155 (21%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.