DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and pi15

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:167 Identity:39/167 - (23%)
Similarity:57/167 - (34%) Gaps:53/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIV-------------RNEGVYTENYLE 73
            |:|.||:.|.|.     ..:.||.||.|......:|...:             :|..|.|..|..
 Frog    70 IVEYHNQVRGKVFPPAANMEYMVWDENLAKLAEAWAATCIWDHGPSYLLKFLGQNLSVRTGRYKS 134

  Fly    74 YLYATDPISAKHLQVVCVFREALPREC-----VRIW----FHYRGFAENTKYYRFTAMIWNASTR 129
            .|....|    ....|..:....|:||     :|.:    .||            |.|:|..:.|
 Frog   135 ILQLVKP----WYDEVKDYAFPYPQECNPRCPLRCYGPMCTHY------------TQMVWATTNR 183

  Fly   130 LGVGL---------GRI-QETRYLVVRYAPPGNILRE 156
            :|..:         |.: :...|||..|:|.||.:.|
 Frog   184 IGCAIHTCHNMNVWGAVWRRAVYLVCNYSPKGNWIGE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 37/162 (23%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.