DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and crispld1a

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_001920421.2 Gene:crispld1a / 100149104 ZFINID:ZDB-GENE-090612-1 Length:508 Species:Danio rerio


Alignment Length:167 Identity:41/167 - (24%)
Similarity:62/167 - (37%) Gaps:61/167 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYAD-------------EIVRNEGVYTENYLE 73
            ||:.||:.|.:.     ..:.||.|.||.....|:|:             :|.:|.||:...|  
Zfish    70 ILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLLPQIGQNLGVHWGRY-- 132

  Fly    74 YLYATDPISAKHLQV----VCVFREALPREC---------VRIWFHYRGFAENTKYYRFTAMIWN 125
                ..|.|  |:|.    |..:....|:||         ..:..||            |.::|.
Zfish   133 ----RPPTS--HVQAWYDEVKDYSFPYPQECNPHCPFRCSGPVCTHY------------TQLVWA 179

  Fly   126 ASTRLGVGL---------GRI-QETRYLVVRYAPPGN 152
            .|:|:|..:         |:| .:..|||..|:|.||
Zfish   180 TSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 41/167 (25%)
crispld1aXP_001920421.2 SCP_euk 68..212 CDD:240180 37/161 (23%)
LCCL 298..381 CDD:128866
LCCL 401..500 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.