DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and XB5812873

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:178 Identity:35/178 - (19%)
Similarity:53/178 - (29%) Gaps:71/178 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSLILEAHNRRRA------------KYGNQPMVLDEELCTECS-------------EYADEIVRN 63
            |:.|::.||..|:            .:.|..:...:|....||             |:|.|.:.|
 Frog    67 RNFIVDKHNYYRSWVNPPAADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQYGGEFAGENIMN 131

  Fly    64 EGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYY----------- 117
            .  |..:..||:                         :..||:..   .|.:|.           
 Frog   132 S--YFRHSWEYV-------------------------INYWFNEH---VNWEYAVGTTKEGAVTG 166

  Fly   118 RFTAMIWNASTRLGVGLGRIQETRY---LVVRYAPPGNILREMASNVP 162
            .||.:||..:..|...:.:...|.|   .|..|.|.||  ||.....|
 Frog   167 HFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYPTGN--REDKVKTP 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 30/164 (18%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 29/163 (18%)
Crisp 219..269 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.