DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG34171

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:236 Identity:65/236 - (27%)
Similarity:100/236 - (42%) Gaps:23/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 CGGALIANNFVLTAAHC-ADLGGEPPSQ----VRLGGDNLTLTEGED--ISIRRVIIHPDYSAST 220
            |.|.::.|..|||:||| .|..|...|.    |.|........|.|:  :.|..:||||.|..: 
  Fly    57 CTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYHRN- 120

  Fly   221 AYNDIALLELETAAKPE---LKPTCIWTQK-EVTN---TLVTAIGYGQTSFAGLSSAQLLKVPLK 278
            .:||||:::|:...|.:   |.|..:.... ||.|   |:....|..:..|....|..|:.|.|:
  Fly   121 QHNDIAIIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLLVNVELR 185

  Fly   279 SVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGC 343
            ..  :||....:....|:......:|..  :.|:..|..|.||||.....|.|..:|..:    |
  Fly   186 PF--DECLKVKKSLMAARPENEDLICVK--STEKQMCTTDFGGPLFCDGQLYGIALGSIN----C 242

  Fly   344 ASGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSFS 384
            :|..|..::.||.:..|:..|:..|...|.....::.:.||
  Fly   243 SSPDPVFFSDVSFYNSWVTKIISEAVDHTRPFIADRFSLFS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 60/214 (28%)
Tryp_SPc 132..361 CDD:214473 59/211 (28%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/211 (28%)
Tryp_SPc 38..263 CDD:304450 60/214 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.