DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and LOC4577519

DIOPT Version :10

Sequence 1:NP_572492.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_061513842.1 Gene:LOC4577519 / 4577519 VectorBaseID:AGAMI1_007013 Length:63 Species:Anopheles gambiae


Alignment Length:52 Identity:25/52 - (48%)
Similarity:28/52 - (53%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCA 180
            |..|.||......||..|..:|| :....:|.|.|||.||...|||||||||
Mosquito     8 FYGVFGGFRALRDEFQHMVVIGW-TRASGKIDYLCGGTLIIKQFVLTAAHCA 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_572492.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 24/49 (49%)
LOC4577519XP_061513842.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.