DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:109/250 - (43%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            :..|.|....:.|::..|.:..|.:    :.|||::|.|.:|||||||.:           |...
  Fly    38 ITNGYPAYEGKVPYIVGLLFSGNGN----WWCGGSIIGNTWVLTAAHCTN-----------GASG 87

  Fly   197 LTLTEGEDISIR------------RVIIHPDYSASTAYNDIALLEL------ETAAKPELKPTCI 243
            :|:..|  .|:|            ..:.|..|::...:|||:|:..      ....|.|| |:..
  Fly    88 VTINYG--ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTPHVDFWHLVNKVEL-PSYN 149

  Fly   244 WTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDI 308
            ...::.......|.|:|.|.........|..|.::.:|..:|...:.        |...|...:.
  Fly   150 DRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWS--------LHDNMICINT 206

  Fly   309 TGERDTCQGDSGGPLLMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWI 361
            .|.:.||.|||||||:..:|  ..:||:||.  ..||.||.|:|::||:.::|||
  Fly   207 NGGKSTCGGDSGGPLVTHEG--NRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 67/249 (27%)
Tryp_SPc 132..361 CDD:214473 66/248 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 66/248 (27%)
Tryp_SPc 38..262 CDD:238113 67/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.