DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:240 Identity:70/240 - (29%)
Similarity:113/240 - (47%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG---- 202
            :.|::..:...||.:   ::.|||::|.:.:|||||||.           .|.|..:|..|    
  Fly    51 QVPYIVGVSLNSNGN---WWWCGGSIIGHTWVLTAAHCT-----------AGADEASLYYGAVNY 101

  Fly   203 ------EDISIRRVIIHPDYSASTAYNDIALLE------LETAAKPELKPTCIWTQKEVTNTLVT 255
                  ..:|....|.:|.|....  :|:||::      .....|.|| |:.........|..|.
  Fly   102 NEPAFRHTVSSENFIRYPHYVGLD--HDLALIKTPHVDFYSLVNKIEL-PSLDDRYNSYENNWVQ 163

  Fly   256 AIGYGQTSFAGLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDS 319
            |.|:| ..:.|.:..:.|: |.||.:|..|||.:|..|..::..:..:...|     :.||||||
  Fly   164 AAGWG-AIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDG-----KATCQGDS 222

  Fly   320 GGPLLMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWIE 362
            ||||:.::|  ..::||||.  ..||..|.|:.:|||:.:::||:
  Fly   223 GGPLVTKEG--DKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 70/240 (29%)
Tryp_SPc 132..361 CDD:214473 68/237 (29%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 68/237 (29%)
Tryp_SPc 41..266 CDD:238113 70/240 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.