DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG11843

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:243 Identity:101/243 - (41%)
Similarity:131/243 - (53%) Gaps:14/243 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGG-D 195
            :|||.|.:|||||.||.||.|.:...|..:.|||.||:..||||||||.:......:.||||. |
  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132

  Fly   196 NLTLTEG---EDISIRRVIIHPDYSASTAYNDIALLELETAAKPEL--KPTCIWTQKEVTNTLVT 255
            ..:|.|.   .|..:...|.||.|.....|:||.|::|..|...:|  .|.|:..|.|.::....
  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFI 197

  Fly   256 AIGYGQTSFAGLSSAQLLKVPLKSVSNEECQH--HYQKDQLAQGVLG-TQMCAGDITGERDTCQG 317
            |:|:|.|..|...|||||||.|:...|..|:.  ..|.::..:|..| .|:|.|....: |||.|
  Fly   198 AVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ-DTCNG 261

  Fly   318 DSGGPLLM---QDGLLGYVVGITSLGQGCAS-GPPSVYTRVSSFVDWI 361
            ||||||||   :...:..||||||.|..|.| |.|.:||||..::.||
  Fly   262 DSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 101/243 (42%)
Tryp_SPc 132..361 CDD:214473 99/241 (41%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 101/243 (42%)
Tryp_SPc 68..309 CDD:214473 99/241 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.