DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG4815

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:257 Identity:64/257 - (24%)
Similarity:98/257 - (38%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 WRSNFDQRIY----------------------YRCGGALIANNFVLTAAHCAD---------LGG 184
            |...|..|||                      ..|...|:....:||||||.:         :||
  Fly    27 WTGRFHPRIYNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGG 91

  Fly   185 EPPSQVRLGGDNLTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIWTQKEV 249
            : .::....|:|....:     :.||.|||.|:......|:|:.:    .|..|:...|...:..
  Fly    92 K-SAEFTWHGNNFNKNK-----LIRVQIHPKYAKMKFIADVAVAK----TKYPLRSKYIGYAQLC 146

  Fly   250 TNTL-----VTAIGYGQTSFAG-------LSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQ 302
            .:.|     :.|.|:|   |.|       ..:.:.:||.:  ||..:|:     .||.:.:....
  Fly   147 RSVLHPRDKLIAAGWG---FEGGVWDESRKKTFRSMKVGI--VSKRDCE-----KQLDRKMPPNI 201

  Fly   303 MCAGDITGERDTCQGDSGGPLLMQDGLLG-YVVGITSLGQGCASG-PPSVYTRVSSFVDWIE 362
            :||| ....:..|.|||||||     ||| .|.||.:....|.:. .|.||..|..:..:|:
  Fly   202 ICAG-AYNNKTLCFGDSGGPL-----LLGRQVCGINTWTFKCGNNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 64/257 (25%)
Tryp_SPc 132..361 CDD:214473 63/254 (25%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 59/235 (25%)
Trypsin 49..256 CDD:278516 58/232 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.