DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG16710

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:409 Identity:118/409 - (28%)
Similarity:177/409 - (43%) Gaps:104/409 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RVYLHLLLVSLPLLAVHATPAISPQSLRGIIFPVETFDECQLEDVARTKGTCRRMEDCPSALNGW 76
            |||:..|::...||...|.....|               |.|::      .|..:..|.|.|...
  Fly     6 RVYISFLVLHTQLLMYLAESEYPP---------------CNLDE------KCISLARCTSLLPFL 49

  Fly    77 LERRESP--KTCYFVRF-----------DHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEF 128
            .....:|  |..:..|:           |..:.|.|.:..|:..:  |.|..:....:       
  Fly    50 KPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPNT--QICGPIMPAYR------- 105

  Fly   129 FVSVVGGMPTRPREFPFMAALGW----RSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQ 189
               :.||..|:|.|.|:||.:.:    ||.:::|:..||.|:||.|.:|||||||..:.|....:
  Fly   106 ---IFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRR 167

  Fly   190 VRLGGDNL-------TLTEGE------------DISIRRVIIHPDYSA--STAYNDIALLELETA 233
            ||||..|:       |...|.            |:||:    |..|..  ...|||||||.|:..
  Fly   168 VRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIK----HRHYMVFEERPYNDIALLRLKFP 228

  Fly   234 AK--PELKPTC-----IWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQK 291
            .:  .::||.|     |::....:|..:...|:|.:...|.|:. ||:..:...:.:||      
  Fly   229 VRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNV-LLQAYVNGRNADEC------ 286

  Fly   292 DQLAQGVLG----TQMCAGDITGERDTCQGDSGGPL--LMQ--DGLLGYVVGITSLGQG-CASGP 347
             .|::..||    |.:|||:: |..|||:|||||||  :|:  |....|:.||||.|.. |..| 
  Fly   287 -SLSEPSLGLDKETHICAGNL-GGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYG- 348

  Fly   348 PSVYTRVSSFVDWIEGIVW 366
            |:.||:.|.||:|   |:|
  Fly   349 PAAYTKTSKFVEW---ILW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 10/59 (17%)
Tryp_SPc 132..364 CDD:238113 93/272 (34%)
Tryp_SPc 132..361 CDD:214473 92/269 (34%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 8/48 (17%)
Tryp_SPc 105..362 CDD:214473 93/283 (33%)
Tryp_SPc 106..362 CDD:238113 93/272 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437414
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.