DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG5255

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:275 Identity:75/275 - (27%)
Similarity:117/275 - (42%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAAL-GWRSNFDQRIYYRCGGA 166
            |:|..:|..|...|......|.      .:|||........|:..:| |..|.     .:.||||
  Fly     7 PLVLFTSSAASQILYPPQYTKN------RIVGGEEAAAGLAPYQISLQGIGSG-----AHSCGGA 60

  Fly   167 LIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIR--------RVIIHPDYSASTAYN 223
            :|...:::|||||.  .|...:..|:      ||..:|:...        |::.|.:|:.....|
  Fly    61 IIDERWIITAAHCT--RGRQATAFRV------LTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRN 117

  Fly   224 DIALLEL------ETAAKP-ELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVS 281
            |||||.|      :.|.:| ||....:     |..:.:...|:|..|..|...|:|..:.:..|.
  Fly   118 DIALLHLNESIVFDNATQPVELDHEAL-----VPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVP 177

  Fly   282 NEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCASG 346
            .|:|:..:  |...:..:| .:|..:..| |..|.|||||||:..    |.:|.:.:.|..||.|
  Fly   178 FEQCRAAH--DNSTRVDIG-HVCTFNDKG-RGACHGDSGGPLVHN----GKLVALVNWGLPCAKG 234

  Fly   347 PPSVYTRVSSFVDWI 361
            .|..:..:|.:.|:|
  Fly   235 YPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 69/246 (28%)
Tryp_SPc 132..361 CDD:214473 68/244 (28%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 68/245 (28%)
Tryp_SPc 30..252 CDD:238113 69/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.