DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG4053

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:239 Identity:62/239 - (25%)
Similarity:108/239 - (45%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALG--WRSNFDQRIYYRCGGALIANNFVLTAAHCA-DLGGEPPSQVR-L 192
            :|||........|:..::.  |:::.       |.|.::...::|||.||| |...|   .:| :
  Fly    35 IVGGQEAEDGVAPYQVSIQTIWKTHI-------CSGVILNEQWILTAGHCALDFSIE---DLRII 89

  Fly   193 GGDNLTLTEGEDISIRRVIIHPDYSASTAY-NDIALLELETAAKPELKPTCIWTQKE--VTNTLV 254
            .|.|..|..|:.:.....::|..|.....| |||||:.:..:.....:...:...:|  ...:.|
  Fly    90 VGTNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTV 154

  Fly   255 TAIGYG--QTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQG 317
            |..|:|  ::|:..:...|.|.:.:  :::|||:..:   ....|:....:|.....|| ..|.|
  Fly   155 TLTGWGAPESSYPTVQYLQTLNLTI--IAHEECRERW---DFHDGIDIGHICTFTREGE-GACSG 213

  Fly   318 DSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWI 361
            ||||||:.:    |.:||:.:.|:.|..|.|.:|.....:.|||
  Fly   214 DSGGPLMWE----GKLVGLVNWGRACGVGMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 62/239 (26%)
Tryp_SPc 132..361 CDD:214473 60/237 (25%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 60/237 (25%)
Tryp_SPc 35..256 CDD:238113 62/239 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.